Structure of PDB 1fuj Chain A

Receptor sequence
>1fujA (length=221) Species: 9606 (Homo sapiens) [Search protein sequence]
IVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLRDIP
QRLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDILLIQLSSP
ANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTV
VTFFCRPHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIWGCATR
LFPDFFTRVALYVDWIRSTLR
3D structure
PDB1fuj The crystal structure of PR3, a neutrophil serine proteinase antigen of Wegener's granulomatosis antibodies.
ChainA
Resolution2.2 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H57 D102 F192 G193 D194 S195 G196
Catalytic site (residue number reindexed from 1) H44 D91 F173 G174 D175 S176 G177
Enzyme Commision number 3.4.21.76: myeloblastin.
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 NAG A L137 N159 L126 N147
BS02 FUC A Q135 I200 C201 D202 G207 Q124 I181 C182 D183 G184
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
GO:0005102 signaling receptor binding
GO:0005515 protein binding
GO:0008236 serine-type peptidase activity
GO:0019899 enzyme binding
Biological Process
GO:0006508 proteolysis
GO:0006509 membrane protein ectodomain proteolysis
GO:0008284 positive regulation of cell population proliferation
GO:0019730 antimicrobial humoral response
GO:0030574 collagen catabolic process
GO:0043547 positive regulation of GTPase activity
GO:0045217 cell-cell junction maintenance
GO:0050765 negative regulation of phagocytosis
GO:0072672 neutrophil extravasation
GO:0097029 mature conventional dendritic cell differentiation
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0035578 azurophil granule lumen
GO:0043231 intracellular membrane-bounded organelle
GO:0044853 plasma membrane raft
GO:0045121 membrane raft
GO:0062023 collagen-containing extracellular matrix
GO:0070062 extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:1fuj, PDBe:1fuj, PDBj:1fuj
PDBsum1fuj
PubMed8757293
UniProtP24158|PRTN3_HUMAN Myeloblastin (Gene Name=PRTN3)

[Back to BioLiP]