Structure of PDB 1ft6 Chain A

Receptor sequence

>1ft6A (length=208) Species: 915 (Nitrosomonas europaea)

ADAPFEGRKKCSSCHKAQAQSWKDTAHAKAMESLKPNVKKEAKQKAKLDP
AKDYTQDKDCVGCHVDGFGQKGGYTIESPKPMLTGVGCESCHGPGRNFRG
DHRKSGQAFEKSGKKTPRKDLAKKGQDFHFEERCSACHLNYEGSPWKGAK
APYTPFTPEVDAKYTFKFDEMVKEVKAMHEHYKLEGVFEGEPKFKFHDEF
QASAKPAK

3D structure

• PDB: 1ft6 High-resolution structures of the oxidized and reduced states of cytochrome c554 from Nitrosomonas europaea.
• Chain: A
• Resolution: 1.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	A	K10 C11 C14 H15 H92 F98 H102 R103 R118 Q126 L184 E185 V187 F188	K10 C11 C14 H15 H92 F98 H102 R103 R118 Q126 L184 E185 V187 F188
BS02	HEC	A	S33 L34 K39 A42 Y54 D59 C60 C63 H64 C137 H138 N140 Y153 T154 P155 F156 Y164	S33 L34 K39 A42 Y54 D59 C60 C63 H64 C137 H138 N140 Y153 T154 P155 F156 Y164
BS03	HEC	A	H15 Q18 W22 H27 G87 C88 C91 H92 F130 M178 H179 H181 Y182 L184 F194 H197	H15 Q18 W22 H27 G87 C88 C91 H92 F130 M178 H179 H181 Y182 L184 F194 H197
BS04	HEC	A	H27 S33 C63 H64 R133 C134 C137 H138 V172 E174 A177 M178	H27 S33 C63 H64 R133 C134 C137 H138 V172 E174 A177 M178
BS05	DTN	A	G62 C63	G62 C63

Gene Ontology

Molecular Function

• GO:0046872 metal ion binding

Cellular Component

• GO:0042597 periplasmic space

External links

• PDB: RCSB:1ft6, PDBe:1ft6, PDBj:1ft6
• PDBsum: 1ft6
• PubMed: 11372197
• UniProt: Q57142|C554_NITEU Cytochrome c-554 (Gene Name=cycA1)