Structure of PDB 1ft4 Chain A |
>1ft4A (length=140) Species: 9606 (Homo sapiens) [Search protein sequence] |
MDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSF TASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSEN LFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENEC |
|
PDB | 1ft4 Photochemically enhanced binding of small molecules to the tumor necrosis factor receptor-1 inhibits the binding of TNF-alpha. |
Chain | A |
Resolution | 2.9 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
703 |
A |
T61 A62 L67 L71 |
T51 A52 L57 L61 |
PDBbind-CN: -logKd/Ki=6.57,IC50=0.27uM |
|
|
|