Structure of PDB 1fsl Chain A

Receptor sequence
>1fslA (length=143) Species: 3847 (Glycine max) [Search protein sequence]
VAFTEKQDALVSSSFEAFKANIPQYSVVFYTSILEKAPAAKDLFSFLANG
VDPTNPKLTGHAEKLFALVRDSAGQLKASGTVVADAALGSVHAQKAVTDP
QFVVVKEALLKTIKAAVGDKWSDELSRAWEVAYDELAAAIKKA
3D structure
PDB1fsl Structure of ferric soybean leghemoglobin a nicotinate at 2.3 A resolution.
ChainA
Resolution2.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM A F44 H61 K64 L88 H92 V97 Q101 F102 Y133 F44 H61 K64 L88 H92 V97 Q101 F102 Y133
BS02 NIO A Y30 F44 H61 L65 Y30 F44 H61 L65
Gene Ontology
Molecular Function
GO:0005344 oxygen carrier activity
GO:0019825 oxygen binding
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0009399 nitrogen fixation
GO:0009877 nodulation
GO:0015671 oxygen transport
GO:0032025 response to cobalt ion
GO:1901698 response to nitrogen compound
GO:1904880 response to hydrogen sulfide
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1fsl, PDBe:1fsl, PDBj:1fsl
PDBsum1fsl
PubMed15299933
UniProtP02238|LGB3_SOYBN Leghemoglobin 3 (Gene Name=LB3)

[Back to BioLiP]