Structure of PDB 1fs7 Chain A

Receptor sequence

>1fs7A (length=471) Species: 844 (Wolinella succinogenes)

KTAHSQGIEGKAMSEEWARYYPRQFDSWKKTKESDNITDMLKEKPALVVA
WAGYPFSKDYNAPRGHYYALQDNINTLRTGAPVDGKTGPLPSACWTCKSP
DVPRIIEQDGELEYFTGKWAKYGDEIVNTIGCYNCHDDKSAELKSKVPYL
DRGLSAAGFKTFAESTHQEKRSLVCAQCHVEYYFKKTEWKDDKGVDKTAM
VVTLPWSKGISTEQMEAYYDEINFADWTHGISKTPMLKAQHPDWELYKTG
IHGQKGVSCADCHMPYTQEGAVKYSDHKVGNPLDNMDKSCMNCHRESEQK
LKDIVKQKFERKEFLQDIAFDNIGKAHLETGKAMELGATDAELKEIRTHI
RHAQWRADMAIAGHGSFFHAPEEVLRLLASGNEEAQKARIKLVKVLAKYG
AIDYVAPDFETKEKAQKLAKVDMEAFIAEKLKFKQTLEQEWKKQAIAKGR
LNPESLKGVDEKSSYYDKTKK

3D structure

• PDB: 1fs7 Cytochrome c nitrite reductase from Wolinella succinogenes. Structure at 1.6 A resolution, inhibitor binding, and heme-packing motifs.
• Chain: A
• Resolution: 1.6 Å

Enzymatic activity

• Enzyme Commision number: 1.7.2.2: nitrite reductase (cytochrome; ammonia-forming).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	A	E217 Y218 K274 Q276	E181 Y182 K238 Q240
BS02	HEC	A	N97 P99 D108 N109 T112 R114 C130 C133 K134 C214 H215 Y218 F220 H277	N61 P63 D72 N73 T76 R78 C94 C97 K98 C178 H179 Y182 F184 H241
BS03	HEC	A	Y57 Q60 F61 W64 G167 C168 C171 H172 L179 H203 R207 M300 Y302 Y310 S311 H313	Y21 Q24 F25 W28 G131 C132 C135 H136 L143 H167 R171 M264 Y266 Y274 S275 H277
BS04	HEC	A	S70 P99 R100 G101 H102 Y104 A105 D108 C133 K134 I166 C211 C214 H215 H299 V315	S34 P63 R64 G65 H66 Y68 A69 D72 C97 K98 I130 C175 C178 H179 H263 V279
BS05	HEC	A	H215 W280 Y283 H288 S294 C295 C298 H299 N317 P318 L319 H400 G401 F404 H405	H179 W244 Y247 H252 S258 C259 C262 H263 N281 P282 L283 H364 G365 F368 H369
BS06	HEC	A	I287 H288 V293 S325 C326 C329 H330 L337 K344 F404	I251 H252 V257 S289 C290 C293 H294 L301 K308 F368

Gene Ontology

Molecular Function

• GO:0005509 calcium ion binding
• GO:0016491 oxidoreductase activity
• GO:0020037 heme binding
• GO:0042279 nitrite reductase (cytochrome, ammonia-forming) activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009061 anaerobic respiration
• GO:0019645 anaerobic electron transport chain
• GO:0042128 nitrate assimilation

Cellular Component

• GO:0030288 outer membrane-bounded periplasmic space
• GO:0042597 periplasmic space

External links

• PDB: RCSB:1fs7, PDBe:1fs7, PDBj:1fs7
• PDBsum: 1fs7
• PubMed: 10984487
• UniProt: Q9S1E5|NRFA_WOLSU Cytochrome c-552 (Gene Name=nrfA)