Structure of PDB 1frd Chain A

Receptor sequence

>1frdA (length=98) Species: 103690 (Nostoc sp. PCC 7120 = FACHB-418)

ASYQVRLINKKQDIDTTIEIDEETTILDGAEENGIELPFSCHSGSCSSCV
GKVVEGEVDQSDQIFLDDEQMGKGFALLCVTYPRSNCTIKTHQEPYLA

3D structure

• PDB: 1frd Molecular structure of the oxidized, recombinant, heterocyst [2Fe-2S] ferredoxin from Anabaena 7120 determined to 1.7-A resolution.
• Chain: A
• Resolution: 1.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FES	A	F39 C41 H42 G44 C46 C49 C79	F39 C41 H42 G44 C46 C49 C79

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0046872 metal ion binding
• GO:0051536 iron-sulfur cluster binding
• GO:0051537 2 iron, 2 sulfur cluster binding

Biological Process

• GO:0009399 nitrogen fixation
• GO:0022900 electron transport chain
• GO:0043158 heterocyst development

External links

• PDB: RCSB:1frd, PDBe:1frd, PDBj:1frd
• PDBsum: 1frd
• PubMed: 8329401
• UniProt: P11053|FERH_NOSS1 Ferredoxin, heterocyst (Gene Name=fdxH)