Structure of PDB 1frb Chain A

Receptor sequence

>1frbA (length=315) Species: 10090 (Mus musculus)

ATFVELSTKAKMPIVGLGTWKSPPNQVKEAVKAAIDAGYRHIDCAYAYCN
ENEVGEAIQEKIKEKAVQREDLFIVSKLWPTCFEKKLLKEAFQKTLTDLK
LDYLDLYLIHWPQGLQPGKELFPKDDQGRILTSKTTFLEAWEGMEELVDQ
GLVKALGVSNFNHFQIERLLNKPGLKHKPVTNQVECHPYLTQEKLIQYCH
SKGISVTAYSPLGSPDRPSAKPEDPSLLEDPKIKEIAAKHEKTSAQVLIR
FHIQRNVVVIPKSVTPSRIQENIQVFDFQLSDEEMATILSFNRNWRACLL
PETVNMEEYPYDAEY

3D structure

• PDB: 1frb 1.7 A structure of FR-1, a fibroblast growth factor-induced member of the aldo-keto reductase family, complexed with coenzyme and inhibitor.
• Chain: A
• Resolution: 1.7 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D43 Y48 K77 H110
• Catalytic site (residue number reindexed from 1): D43 Y48 K77 H110
• Enzyme Commision number: 1.1.1.21: aldose reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NDP	A	G18 T19 W20 D43 Y48 N160 Q183 Y209 S210 P211 L212 S214 P215 D216 A245 I260 P261 K262 S263 V264 T265 R268 E271 N272	G18 T19 W20 D43 Y48 N160 Q183 Y209 S210 P211 L212 S214 P215 D216 A245 I260 P261 K262 S263 V264 T265 R268 E271 N272
BS02	ZST	A	W20 Y48 H110 W111 F122 C298 L300	W20 Y48 H110 W111 F122 C298 L300	MOAD: Kd=30nM

Gene Ontology

Molecular Function

• GO:0004032 aldose reductase (NADPH) activity
• GO:0016491 oxidoreductase activity
• GO:0016918 retinal binding
• GO:0052650 all-trans-retinol dehydrogenase (NADP+) activity
• GO:0070401 NADP+ binding
• GO:0070402 NADPH binding

Biological Process

• GO:0019751 polyol metabolic process
• GO:0042572 retinol metabolic process
• GO:0042574 retinal metabolic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:1frb, PDBe:1frb, PDBj:1frb
• PDBsum: 1frb
• PubMed: 7578036
• UniProt: P45377|ALD2_MOUSE Aldose reductase-related protein 2 (Gene Name=Akr1b8)