Structure of PDB 1fqk Chain A

Receptor sequence

>1fqkA (length=318) Species: 9913,10116

RTVKLLLLGAGESGKSTIVKQMKIIHQDGYSLEECLEFIAIIYGNTLQSI
LAIVRAMTTLNIQYGDSARQDDARKLMHMADTIEEGTMPKEMSDIIQRLW
KDSGIQACFDRASEYQLNDSAGYYLSDLERLVTPGYVPTEQDVLRSRVKT
TGIIETQFSFKDLNFRMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYD
LVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKS
PLTICYPEYAGSNTYEEAGNYIKVQFLELNMRRDVKEIYSHMTCATDTQN
VKFVFDAVTDIIIKENLK

3D structure

• PDB: 1fqk Structural determinants for regulation of phosphodiesterase by a G protein at 2.0 A.
• Chain: A
• Resolution: 2.3 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E39 T44 R174 D196 Q200
• Catalytic site (residue number reindexed from 1): E12 T17 R147 D169 Q173

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	A	S43 T177	S16 T150
BS02	ALF	A	G38 E39 K42 R174 K176 T177 G199 Q200	G11 E12 K15 R147 K149 T150 G172 Q173
BS03	GDP	A	E39 S40 G41 K42 S43 T44 D146 L171 R172 S173 R174 N265 K266 D268 L269 C321 A322 T323	E12 S13 G14 K15 S16 T17 D119 L144 R145 S146 R147 N238 K239 D241 L242 C294 A295 T296

Gene Ontology

Molecular Function

• GO:0003924 GTPase activity
• GO:0005525 GTP binding
• GO:0019001 guanyl nucleotide binding
• GO:0031683 G-protein beta/gamma-subunit complex binding

Biological Process

• GO:0007165 signal transduction
• GO:0007186 G protein-coupled receptor signaling pathway
• GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway

External links

• PDB: RCSB:1fqk, PDBe:1fqk, PDBj:1fqk
• PDBsum: 1fqk
• PubMed: 11234020
• UniProt: P04695|GNAT1_BOVIN Guanine nucleotide-binding protein G(t) subunit alpha-1 (Gene Name=GNAT1);
  P10824|GNAI1_RAT Guanine nucleotide-binding protein G(i) subunit alpha-1 (Gene Name=Gnai1)