Structure of PDB 1fkb Chain A

Receptor sequence

>1fkbA (length=107) Species: 9606 (Homo sapiens) [Search protein sequence]

GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFML
GKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFD
VELLKLE

3D structure

PDB

1fkb Atomic Structure of the Rapamycin Human Immunophilin Fkbp-12 Complex

Chain

Resolution

1.7 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

Enzymatic activity

Catalytic site (original residue number in PDB)	Y26 F36 D37 I56 Y82 F99
Catalytic site (residue number reindexed from 1)	Y26 F36 D37 I56 Y82 F99
Enzyme Commision number	5.2.1.8: peptidylprolyl isomerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	RAP	A	Y26 F36 D37 F46 Q53 E54 V55 I56 W59 Y82 F99	Y26 F36 D37 F46 Q53 E54 V55 I56 W59 Y82 F99	MOAD: Kd=0.2nM PDBbind-CN: -logKd/Ki=9.70,Kd=0.2nM BindingDB: IC50=0.600000nM,EC50=30nM,Ki=0.20nM

Gene Ontology

	Molecular Function
GO:0003755	peptidyl-prolyl cis-trans isomerase activity
GO:0005160	transforming growth factor beta receptor binding
GO:0005515	protein binding
GO:0005527	macrolide binding
GO:0005528	FK506 binding
GO:0016247	channel regulator activity
GO:0030547	signaling receptor inhibitor activity
GO:0034713	type I transforming growth factor beta receptor binding
GO:0044325	transmembrane transporter binding
GO:0070411	I-SMAD binding
GO:0070697	activin receptor binding

	Biological Process
GO:0000413	protein peptidyl-prolyl isomerization
GO:0003007	heart morphogenesis
GO:0006457	protein folding
GO:0006458	'de novo' protein folding
GO:0014809	regulation of skeletal muscle contraction by regulation of release of sequestered calcium ion
GO:0022417	protein maturation by protein folding
GO:0030512	negative regulation of transforming growth factor beta receptor signaling pathway
GO:0032092	positive regulation of protein binding
GO:0032880	regulation of protein localization
GO:0032926	negative regulation of activin receptor signaling pathway
GO:0042026	protein refolding
GO:0042110	T cell activation
GO:0043123	positive regulation of canonical NF-kappaB signal transduction
GO:0050776	regulation of immune response
GO:0055010	ventricular cardiac muscle tissue morphogenesis
GO:0060314	regulation of ryanodine-sensitive calcium-release channel activity
GO:0060347	heart trabecula formation
GO:0070588	calcium ion transmembrane transport
GO:0097435	supramolecular fiber organization
GO:1902991	regulation of amyloid precursor protein catabolic process
GO:1990000	amyloid fibril formation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0014802	terminal cisterna
GO:0016020	membrane
GO:0016529	sarcoplasmic reticulum
GO:0030018	Z disc
GO:0033017	sarcoplasmic reticulum membrane
GO:0098562	cytoplasmic side of membrane
GO:1990425	ryanodine receptor complex

External links

PDB	RCSB:1fkb, PDBe:1fkb, PDBj:1fkb
PDBsum	1fkb
PubMed
UniProt	P62942\|FKB1A_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP1A (Gene Name=FKBP1A)