Structure of PDB 1fjx Chain A

Receptor sequence

>1fjxA (length=327) Species: 726 (Haemophilus haemolyticus)

MIEIKDKQLTGLRFIDLFAGLGGFRLALESCGAECVYSNEWDKYAQEVYE
MNFGEKPEGDITQVNEKTIPDHDILCAGFPCQAFSISGKQKGFEDSRGTL
FFDIARIVREKKPKVVFMENVKNFASHDNGNTLEVVKNTMNELDYSFHAK
VLNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDS
EVEHLVIDRKDLVMTNQEIEQTTPKTVRLGIVGKGGQGERIYSTRGIAIG
LSAYGGGIFAKTGGYLVNGKTRKLHPRECARVMGYPDSYKVHPSTSQAYK
QFGNSVVINVLQYIAYNIGSSLNFKPY

3D structure

• PDB: 1fjx Functional roles of the conserved threonine 250 in the target recognition domain of HhaI DNA methyltransferase.
• Chain: A
• Resolution: 2.26 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.37: DNA (cytosine-5-)-methyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	D42 K43 Y44 I86 K234 G236 Q237 G256 G257 I258 S294 Q297	D42 K43 Y44 I86 K234 G236 Q237 G256 G257 I258 S294 Q297	PDBbind-CN: Kd=1.4nM
BS02	dna	A	F79 C81 S85 I86 S87 K89 E119 V121 K162 R165 T226 R228 Q237 R240 Y242 G250 S252 A253 Y254 G303 N304	F79 C81 S85 I86 S87 K89 E119 V121 K162 R165 T226 R228 Q237 R240 Y242 G250 S252 A253 Y254 G303 N304	PDBbind-CN: Kd=1.4nM
BS03	SAH	A	F18 A19 L21 G23 E40 W41 D60 G78 N304 S305	F18 A19 L21 G23 E40 W41 D60 G78 N304 S305

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003886 DNA (cytosine-5-)-methyltransferase activity
• GO:0008168 methyltransferase activity

Biological Process

• GO:0009307 DNA restriction-modification system
• GO:0032259 methylation

External links

• PDB: RCSB:1fjx, PDBe:1fjx, PDBj:1fjx
• PDBsum: 1fjx
• PubMed: 11102456
• UniProt: P05102|MTH1_HAEPH Type II methyltransferase M.HhaI (Gene Name=hhaIM)