Structure of PDB 1fiw Chain A

Receptor sequence

>1fiwA (length=260) Species: 9940 (Ovis aries)

IIGGQDAAHGAWPWMVSLQIFTYHNNRRYHVCGGSLLNSQWLLTAAHCFR
IKKKVTDWRLIFGAKEVEWGTNKPVKPPLQERYVEKIIIHEKYSASSEAN
DIALMKITPPVTCGHFIGPGCLPQFRAGPPRVPQTCWVAGWGFLQENARR
TSPMLQEARVDLIDLGLCNSTRWYNGRIRSTNVCAGYPEGKIDTCQGDSG
GPLMCKDSAENSYVVVGITSWGVGCARAKRPGVYTSTWSYLNWIASKIGS
TAVHMIQLPT

3D structure

• PDB: 1fiw Effector sites in the three-dimensional structure of mammalian sperm beta-acrosin.
• Chain: A
• Resolution: 2.1 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H57 D102 Q192 G193 D194 S195 G196
• Catalytic site (residue number reindexed from 1): H47 D101 Q196 G197 D198 S199 G200
• Enzyme Commision number: 3.4.21.10: acrosin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	H24 G25 A26 W27 P28 W29 T113 C114 G115 H116 F117 P120 G121 C122 S202D Y203 I250	H9 G10 A11 W12 P13 W14 T112 C113 G114 H115 F116 P119 G120 C121 S212 Y213 I256
BS02	FUL	A	N173 G174	N175 G176
BS03	PBZ	A	D189 T190 Q192 W215 G216 G219 C220	D193 T194 Q196 W221 G222 G224 C225
BS04	PBZ	A	Y84 V85 E86	Y83 V84 E85

Gene Ontology

Molecular Function

• GO:0004040 amidase activity
• GO:0004252 serine-type endopeptidase activity
• GO:0005537 D-mannose binding
• GO:0008236 serine-type peptidase activity
• GO:0042806 fucose binding

Biological Process

• GO:0006508 proteolysis
• GO:0007190 activation of adenylate cyclase activity
• GO:0007338 single fertilization
• GO:0007340 acrosome reaction

External links

• PDB: RCSB:1fiw, PDBe:1fiw, PDBj:1fiw
• PDBsum: 1fiw
• PubMed: 11080640
• UniProt: Q9GL10|ACRO_SHEEP Acrosin (Fragment) (Gene Name=ACR)