Structure of PDB 1fhb Chain A

Receptor sequence
>1fhbA (length=108) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
TEFKAGSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRQSGQAEG
YSYTDANIKKNVLWDENNMSEYLTNPKKYIPGTKAAFGGLKKEKDRNDLI
TYLKKASE
3D structure
PDB1fhb Three-Dimensional Solution Structure of the Cyanide Adduct of a met80Ala Variant of Saccharomyces Cerevisiae Iso-1-Cytochrome C. Identification of Ligand-Residue Interactions in the Distal Heme Cavity
ChainA
ResolutionN/A
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CYN A Y67 P71 A80 Y72 P76 A85
BS02 HEM A C14 C17 H18 V28 G29 P30 L32 I35 S40 G41 T49 N52 W59 M64 Y67 L68 T78 A80 F82 C19 C22 H23 V33 G34 P35 L37 I40 S45 G46 T54 N57 W64 M69 Y72 L73 T83 A85 F87
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
GO:1901612 cardiolipin binding
Biological Process
GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c
GO:0006123 mitochondrial electron transport, cytochrome c to oxygen
Cellular Component
GO:0005739 mitochondrion
GO:0005758 mitochondrial intermembrane space

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1fhb, PDBe:1fhb, PDBj:1fhb
PDBsum1fhb
PubMed7547866
UniProtP00044|CYC1_YEAST Cytochrome c isoform 1 (Gene Name=CYC1)

[Back to BioLiP]