Structure of PDB 1ff2 Chain A

Receptor sequence

>1ff2A (length=106) Species: 354 (Azotobacter vinelandii)

AFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDECIDDALCEPECP
AQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGK
LQHLER

3D structure

• PDB: 1ff2 Structure of C42D Azotobacter vinelandii FdI. A Cys-X-X-Asp-X-X-Cys motif ligates an air-stable [4Fe-4S]2+/+ cluster
• Chain: A
• Resolution: 2.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	A	F2 C20 P21 C24 F25 I34 C39 I40 D42 A43 C45	F2 C20 P21 C24 F25 I34 C39 I40 D42 A43 C45
BS02	F3S	A	C8 K12 Y13 T14 C16 L32 C49 I54	C8 K12 Y13 T14 C16 L32 C49 I54

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0009055 electron transfer activity
• GO:0046872 metal ion binding
• GO:0051538 3 iron, 4 sulfur cluster binding
• GO:0051539 4 iron, 4 sulfur cluster binding

External links

• PDB: RCSB:1ff2, PDBe:1ff2, PDBj:1ff2
• PDBsum: 1ff2
• PubMed: 10961993
• UniProt: P00214|FER1_AZOVI Ferredoxin-1 (Gene Name=fdxA)