Structure of PDB 1fe3 Chain A

Receptor sequence

>1fe3A (length=131) Species: 9606 (Homo sapiens)

VEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVV
IRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGK
ETNFVREIKDGKMVMTLTFGDVVAVRHYEKA

3D structure

• PDB: 1fe3 Crystal structure and thermodynamic analysis of human brain fatty acid-binding protein.
• Chain: A
• Resolution: 2.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	OLA	A	G33 K58 D76 Y128	G33 K58 D76 Y128	PDBbind-CN: -logKd/Ki=7.33,Kd=46.7nM

Gene Ontology

Molecular Function

• GO:0005504 fatty acid binding
• GO:0005515 protein binding
• GO:0008289 lipid binding

Biological Process

• GO:0007399 nervous system development
• GO:0008285 negative regulation of cell population proliferation
• GO:0015908 fatty acid transport
• GO:0050673 epithelial cell proliferation

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:1fe3, PDBe:1fe3, PDBj:1fe3
• PDBsum: 1fe3
• PubMed: 10854433
• UniProt: O15540|FABP7_HUMAN Fatty acid-binding protein, brain (Gene Name=FABP7)