Structure of PDB 1fd8 Chain A |
>1fd8A (length=73) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] |
MAEIKHYQFNVVMTCSGCSGAVNKVLTKLEPDVSKIDISLEKQLVDVYTT LPYDFILEKIKKTGKEVRSGKQL |
|
PDB | 1fd8 Solution structure of the Cu(I) and apo forms of the yeast metallochaperone, Atx1. |
Chain | A |
Resolution | N/A |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU1 |
A |
C15 C18 K65 |
C15 C18 K65 |
|
|
|
|