Structure of PDB 1f6b Chain A

Receptor sequence
>1f6bA (length=176) Species: 10029 (Cricetulus griseus) [Search protein sequence]
SSVLQFLGLYKKTGKLVFLGLDNAGKTTLLHMLKDDPTLHPTSEELTIAG
MTFTTFDLGGRRVWKNYLPAINGIVFLVDCADHERLLESKEELDSLMTDE
TIANVPILILGNKIDRPEAISEERLREMFGLYGQTTGKGSVSLKELNARP
LEVFMCSVLKRQGYGEGFRWMAQYID
3D structure
PDB1f6b Crystal structure of Sar1-GDP at 1.7 A resolution and the role of the NH2 terminus in ER export.
ChainA
Resolution1.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.6.5.2: small monomeric GTPase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MG A D34 D75 D22 D57
BS02 GDP A D34 N35 A36 G37 K38 T39 T40 H58 N134 K135 D137 S179 L181 D22 N23 A24 G25 K26 T27 T28 H40 N112 K113 D115 S157 L159
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0003925 G protein activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0016787 hydrolase activity
GO:0046872 metal ion binding
GO:0140785 amino acid sensor activity
Biological Process
GO:0003400 regulation of COPII vesicle coating
GO:0006886 intracellular protein transport
GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0015031 protein transport
GO:0016050 vesicle organization
GO:0016192 vesicle-mediated transport
GO:0032368 regulation of lipid transport
GO:0042953 lipoprotein transport
GO:0048208 COPII vesicle coating
GO:0055088 lipid homeostasis
GO:0061024 membrane organization
GO:0070863 positive regulation of protein exit from endoplasmic reticulum
GO:0090110 COPII-coated vesicle cargo loading
GO:0140353 lipid export from cell
GO:1903432 regulation of TORC1 signaling
GO:1904262 negative regulation of TORC1 signaling
GO:1990253 cellular response to leucine starvation
Cellular Component
GO:0005737 cytoplasm
GO:0005764 lysosome
GO:0005765 lysosomal membrane
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0016020 membrane
GO:0030127 COPII vesicle coat
GO:0032580 Golgi cisterna membrane
GO:0070971 endoplasmic reticulum exit site

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1f6b, PDBe:1f6b, PDBj:1f6b
PDBsum1f6b
PubMed11739406
UniProtQ9QVY3|SAR1B_CRIGR Small COPII coat GTPase SAR1B (Gene Name=SAR1B)

[Back to BioLiP]