Structure of PDB 1f4n Chain A |
>1f4nA (length=59) Species: 562 (Escherichia coli) [Search protein sequence] |
GTKQEKTILNMARFIRSQALTILEKANELDADEIADIAESIHDHADEIYR SALARFGDD |
|
PDB | 1f4n Dramatic structural and thermodynamic consequences of repacking a protein's hydrophobic core. |
Chain | A |
Resolution | 1.9 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
A |
F56 D58 |
F56 D58 |
|
BS02 |
CA |
A |
A54 D58 |
A54 D58 |
|
|
|
|