Structure of PDB 1f3p Chain A

Receptor sequence

>1f3pA (length=401) Species: 307 (Pseudomonas sp. KKS102)

ALKAPVVVLGAGLASVSFVAELRQAGYQGLITVVGDEAERPYDRPPLSKD
FMAHGDAEKIRLDCKRAPEVEWLLGVTAQSFDPQAHTVALSDGRTLPYGT
LVLATGAAPRALPTLQGATMPVHTLRTLEDARRIQAGLRPQSRLLIVGGG
VIGLELAATARTAGVHVSLVETQPRLMSRAAPATLADFVARYHAAQGVDL
RFERSVTGSVDGVVLLDDGTRIAADMVVVGIGVLANDALARAAGLACDDG
IFVDAYGRTTCPDVYALGDVTRQRNPLSGRFERIETWSNAQNQGIAVARH
LVDPTAPGYAELPWYWSDQGALRIQVAGLASGDEEIVRGEVSLDAPKFTL
IELQKGRIVGATCVNNARDFAPLRRLLAVGAKPDRAALADPATDLRKLAA
A

3D structure

• PDB: 1f3p Crystal structure of NADH-dependent ferredoxin reductase component in biphenyl dioxygenase.
• Chain: A
• Resolution: 2.4 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): L17 R48 P49 Q295
• Catalytic site (residue number reindexed from 1): L13 R44 P45 Q291
• Enzyme Commision number: 1.14.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	A	A18 V38 D40 E41 R48 P49 A82 T109 G110 R130 G272 D273 E289 T290 W291 A294 W320	A14 V34 D36 E37 R44 P45 A78 T105 G106 R126 G268 D269 E285 T286 W287 A290 W316
BS02	NAD	A	V151 G152 G154 V155 I156 E159 E175 T176 R183 G234 I235 G236 V237 E289 W320 S321	V147 G148 G150 V151 I152 E155 E171 T172 R179 G230 I231 G232 V233 E285 W316 S317

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0016491 oxidoreductase activity
• GO:0016651 oxidoreductase activity, acting on NAD(P)H

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:1f3p, PDBe:1f3p, PDBj:1f3p
• PDBsum: 1f3p
• PubMed: 11090282
• UniProt: Q52437