Structure of PDB 1f1f Chain A

Receptor sequence

>1f1fA (length=88) Species: 129910 (Limnospira maxima)

DVAAGASVFSANCAACHMGGRNVIVANKTLSKSDLAKYLKGFDDDAVAAV
AYQVTNGKNAMPGFNGRLSPLQIEDVAAYVVDQAEKGW

3D structure

• PDB: 1f1f Structures of cytochrome c-549 and cytochrome c6 from the cyanobacterium Arthrospira maxima.
• Chain: A
• Resolution: 2.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	A	N13 C14 C17 H18 N23 K29 T30 L31 D35 Q54 K59 N60 A61 M62 F65	N12 C13 C16 H17 N22 K28 T29 L30 D34 Q53 K58 N59 A60 M61 F64

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015979 photosynthesis

Cellular Component

• GO:0009579 thylakoid
• GO:0031977 thylakoid lumen
• GO:0031979 plasma membrane-derived thylakoid lumen

External links

• PDB: RCSB:1f1f, PDBe:1f1f, PDBj:1f1f
• PDBsum: 1f1f
• PubMed: 11478889
• UniProt: P00118|CYC6_LIMMA Cytochrome c6 (Gene Name=petJ)