Structure of PDB 1ezl Chain A |
>1ezlA (length=128) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence] |
AEASVDIQGNDQMQFNTNAITVDKSAKQFTVNLSHPGNLPKNVMGHNWVL STAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVS KLKEGEQYMFFCTFPGHSALMKGTLTLK |
|
PDB | 1ezl Crystal structure of the disulfide bond-deficient azurin mutant C3A/C26A: how important is the S-S bond for folding and stability? |
Chain | A |
Resolution | 2.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
A |
G45 H46 H117 |
G45 H46 H117 |
|
|
|
|