Structure of PDB 1eyi Chain A

Receptor sequence

>1eyiA (length=331) Species: 9823 (Sus scrofa) [Search protein sequence]

DTNIVTLTRFVMEEGRKARGTGEMTQLLNSLCTAVKAISTAVRKAGIAHL
YGIAGSTNVTGDQVKKLDVLSNDLVINVLKSSFATCVLVSEEDKNAIIVE
PEKRGKYVVCFDPLDGSSNIDCLVSIGTIFGIYRKNSTDEPSEKDALQPG
RNLVAAGYALYGSATMLVLAMVNGVNCFMLDPAIGEFILVDRDVKIKKKG
SIYSINEGYAKEFDPAITEYIQRKKFPPDNSAPYGARYVGSMVADVHRTL
VYGGIFMYPANKKSPKGKLRLLYECNPMAYVMEKAGGLATTGKEAVLDIV
PTDIHQRAPIILGSPEDVTELLEIYQKHAAK

3D structure

PDB

1eyi Crystal structures of fructose 1,6-bisphosphatase: mechanism of catalysis and allosteric inhibition revealed in product complexes.

Chain

Resolution

2.32 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	D68 D74 E97 E98 D118 L120 D121 E280
Catalytic site (residue number reindexed from 1)	D62 D68 E91 E92 D112 L114 D115 E274
Enzyme Commision number	3.1.3.11: fructose-bisphosphatase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	F6P	A	D121 G122 N212 Y215 Y244 G246 S247 M248 Y264 K274 E280	D115 G116 N206 Y209 Y238 G240 S241 M242 Y258 K268 E274
BS02	MG	A	E97 D118 L120 D121	E91 D112 L114 D115
BS03	MG	A	D118 D121 E280	D112 D115 E274
BS04	PO4	A	G26 T27 G28 E29 M30 K112 Y113	G20 T21 G22 E23 M24 K106 Y107
BS05	PO4	A	E97 D118 L120 D121 G122 S123 R276	E91 D112 L114 D115 G116 S117 R270

Gene Ontology

	Molecular Function
GO:0016208	AMP binding
GO:0016787	hydrolase activity
GO:0016791	phosphatase activity
GO:0042132	fructose 1,6-bisphosphate 1-phosphatase activity
GO:0042578	phosphoric ester hydrolase activity
GO:0042802	identical protein binding
GO:0046872	metal ion binding
GO:0048029	monosaccharide binding

	Biological Process
GO:0005975	carbohydrate metabolic process
GO:0005986	sucrose biosynthetic process
GO:0006000	fructose metabolic process
GO:0006002	fructose 6-phosphate metabolic process
GO:0006094	gluconeogenesis
GO:0006111	regulation of gluconeogenesis
GO:0016311	dephosphorylation
GO:0030308	negative regulation of cell growth
GO:0030388	fructose 1,6-bisphosphate metabolic process
GO:0045820	negative regulation of glycolytic process
GO:0046580	negative regulation of Ras protein signal transduction
GO:0071286	cellular response to magnesium ion
GO:0071466	cellular response to xenobiotic stimulus

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1eyi, PDBe:1eyi, PDBj:1eyi
PDBsum	1eyi
PubMed	10913263
UniProt	P00636\|F16P1_PIG Fructose-1,6-bisphosphatase 1 (Gene Name=FBP1)

[Back to BioLiP]