Structure of PDB 1exw Chain A

Receptor sequence
>1exwA (length=279) Species: 9913 (Bos taurus) [Search protein sequence]
DPPAPLPLVIWHGMGDSCCNPLSMGAIKKMVEKKIPGIHVLSLEIGKTLR
EDVENSFFLNVNSQVTTVCQILAKDPKLQQGYNAMGFSQGGQFLRAVAQR
CPSPPMVNLISVGGQHQGVFGLPRCPGESSHICDFIRKTLNAGAYNKAIQ
ERLVQAEYWHDPIREDIYRNHSIFLADINQERGVNESYKKNLMALKKFVM
VKFLNDTIVDPVDSEWFGFYRSGQAKETIPLQESTLYTQDRLGLKAMDKA
GQLVFLALEGDHLQLSEEWFYAHIIPFLE
3D structure
PDB1exw Structural basis for the insensitivity of a serine enzyme (palmitoyl-protein thioesterase) to phenylmethylsulfonyl fluoride.
ChainA
Resolution2.4 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) M41 S115 Q116 D233 H289 E294
Catalytic site (residue number reindexed from 1) M14 S88 Q89 D206 H262 E267
Enzyme Commision number 3.1.2.22: palmitoyl-protein hydrolase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HDS A M41 S115 Q116 Q142 A171 W186 M14 S88 Q89 Q115 A144 W159 PDBbind-CN: -logKd/Ki=3.90,Ki=125uM
Gene Ontology
Molecular Function
GO:0008474 palmitoyl-(protein) hydrolase activity
GO:0016787 hydrolase activity
GO:0052816 long-chain fatty acyl-CoA hydrolase activity
GO:0098599 palmitoyl hydrolase activity
GO:0120146 sulfatide binding
Biological Process
GO:0002084 protein depalmitoylation
GO:0006898 receptor-mediated endocytosis
GO:0006907 pinocytosis
GO:0007042 lysosomal lumen acidification
GO:0007399 nervous system development
GO:0007420 brain development
GO:0015031 protein transport
GO:0016042 lipid catabolic process
GO:0030308 negative regulation of cell growth
GO:0031579 membrane raft organization
GO:0043066 negative regulation of apoptotic process
GO:0043524 negative regulation of neuron apoptotic process
GO:0048260 positive regulation of receptor-mediated endocytosis
GO:0048549 positive regulation of pinocytosis
Cellular Component
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005764 lysosome
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0008021 synaptic vesicle
GO:0030424 axon
GO:0045121 membrane raft

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1exw, PDBe:1exw, PDBj:1exw
PDBsum1exw
PubMed10801859
UniProtP45478|PPT1_BOVIN Palmitoyl-protein thioesterase 1 (Gene Name=PPT1)

[Back to BioLiP]