Structure of PDB 1etu Chain A

Receptor sequence
>1etuA (length=177) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
FERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGITINTSHVEYDTPT
RHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLGR
QVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGS
ALKALEGDAEWEAKILELAGFLDSYIP
3D structure
PDB1etu Structural details of the binding of guanosine diphosphate to elongation factor Tu from E. coli as studied by X-ray crystallography.
ChainA
Resolution2.9 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) D21 K24 T25 T61 H84
Catalytic site (residue number reindexed from 1) D17 K20 T21 T38 H61
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GDP A D21 G23 K24 T25 T26 N135 D138 M139 S173 L175 D17 G19 K20 T21 T22 N112 D115 M116 S150 L152
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003746 translation elongation factor activity
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0097216 guanosine tetraphosphate binding
Biological Process
GO:0006412 translation
GO:0006414 translational elongation
GO:0046677 response to antibiotic
Cellular Component
GO:0005737 cytoplasm
GO:0005886 plasma membrane
GO:0032045 guanyl-nucleotide exchange factor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1etu, PDBe:1etu, PDBj:1etu
PDBsum1etu
PubMed3908095
UniProtP0CE47|EFTU1_ECOLI Elongation factor Tu 1 (Gene Name=tufA)

[Back to BioLiP]