Structure of PDB 1eqq Chain A

Receptor sequence
>1eqqA (length=114) Species: 562 (Escherichia coli) [Search protein sequence]
ASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKE
QTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTE
VVVNVGGTMQMLGG
3D structure
PDB1eqq Roles of functional loops and the C-terminal segment of a single-stranded DNA binding protein elucidated by X-Ray structure analysis
ChainA
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna A T85 R86 K87 R96 T85 R86 K87 R96
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003697 single-stranded DNA binding
GO:0005515 protein binding
GO:0008047 enzyme activator activity
GO:0042802 identical protein binding
Biological Process
GO:0000725 recombinational repair
GO:0006260 DNA replication
GO:0006261 DNA-templated DNA replication
GO:0006281 DNA repair
GO:0006298 mismatch repair
GO:0006310 DNA recombination
GO:0009432 SOS response
Cellular Component
GO:0005829 cytosol
GO:0009295 nucleoid
GO:0030894 replisome
GO:0044777 single-stranded DNA-binding protein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1eqq, PDBe:1eqq, PDBj:1eqq
PDBsum1eqq
PubMed10731701
UniProtP0AGE0|SSB_ECOLI Single-stranded DNA-binding protein (Gene Name=ssb)

[Back to BioLiP]