Structure of PDB 1ena Chain A |
>1enaA (length=135) Species: 1280 (Staphylococcus aureus) [Search protein sequence] |
LHKEPATLIKAIDGETVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGP EASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQ GLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS |
|
PDB | 1ena Crystal structures of the binary Ca2+ and pdTp complexes and the ternary complex of the Asp21-->Glu mutant of staphylococcal nuclease. Implications for catalysis and ligand binding. |
Chain | A |
Resolution | 2.15 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
A |
E21 D40 T41 E43 |
E15 D34 T35 E37 |
|
|
|
|