Structure of PDB 1eli Chain A

Receptor sequence

>1eliA (length=385) Species: 69000 (Bacillus sp. B-0618)

STHFDVIVVGAGSMGMAAGYQLAKQGVKTLLVDAFDPPHTNGSHHGDTRI
IRHAYGEGREYVPLALRSQELWYELEKETHHKIFTKTGVLVFGPKGESAF
VAETMEAAKEHSLTVDLLEGDEINKRWPGITVPENYNAIFEPNSGVLFSE
NCIRAYRELAEARGAKVLTHTRVEDFDISPDSVKIETANGSYTADKLIVS
MGAWNSKLLSKLNLDIPLQPYRQVVGFFESDESKYSNDIDFPGFMVEVPN
GIYYGFPSFGGCGLKLGYHTFGQKIDPDTINREFGVYPEDESNLRAFLEE
YMPGANGELKRGAVCMYTKTLDEHFIIDLHPEHSNVVIAAGFSGHGFKFS
SGVGEVLSQLALTGKTEHDISIFSINRPALKESLQ

3D structure

• PDB: 1eli Monomeric sarcosine oxidase: 1. Flavin reactivity and active site binding determinants.
• Chain: A
• Resolution: 2.0 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H45 T48 R49 R52 S98 Y254 K265 H269 C315 H345 K348
• Catalytic site (residue number reindexed from 1): H45 T48 R49 R52 S98 Y254 K265 H269 C315 H345 K348
• Enzyme Commision number: 1.5.3.1: sarcosine oxidasee (formaldehyde-forming).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	A	G10 G12 S13 M14 D33 A34 H39 G42 S43 H44 R49 I50 R172 V173 S200 M201 G202 W204 Y254 C315 M316 Y317 F342 G344 H345 G346 F347 K348	G10 G12 S13 M14 D33 A34 H39 G42 S43 H44 R49 I50 R172 V173 S200 M201 G202 W204 Y254 C315 M316 Y317 F342 G344 H345 G346 F347 K348
BS02	PYC	A	R52 M245 Y254 H269 G344 H345 K348	R52 M245 Y254 H269 G344 H345 K348	MOAD: Kd=1.37mM

Gene Ontology

Molecular Function

• GO:0008115 sarcosine oxidase activity
• GO:0016491 oxidoreductase activity
• GO:0050660 flavin adenine dinucleotide binding

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:1eli, PDBe:1eli, PDBj:1eli
• PDBsum: 1eli
• PubMed: 10913292
• UniProt: P40859|MSOX_BACB0 Monomeric sarcosine oxidase (Gene Name=soxA)