Structure of PDB 1ej8 Chain A |
>1ej8A (length=140) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] |
SSAVAILETFQKYTIDQKKDTAVRGLARIVQVGENKTLFDITVNGVPEAG NYHASIHEKGDVSKGVESTGKVWHKFDEPIECFNESDLGKNLYSGKTFLS APLPTWQLIGRSFVISKSLNHPENEPSSVKDYSFLGVIAR |
|
PDB | 1ej8 X-ray crystallographic and analytical ultracentrifugation analyses of truncated and full-length yeast copper chaperones for SOD (LYS7): a dimer-dimer model of LYS7-SOD association and copper delivery. |
Chain | A |
Resolution | 1.55 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
A |
P124 N168 |
P47 N91 |
|
|
|
|