Structure of PDB 1ehj Chain A

Receptor sequence

>1ehjA (length=68) Species: 891 (Desulfuromonas acetoxidans)

ADVVTYENKKGNVTFDHKAHAEKLGCDACHEGTPAKIAIDKKSAHKDACK
TCHKSNNGPTKCGGCHIK

3D structure

• PDB: 1ehj A proton-NMR investigation of the fully reduced cytochrome c7 from Desulfuromonas acetoxidans. Comparison between the reduced and the oxidized forms.
• Chain: A
• Resolution: N/A

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	A	Y6 F15 H17 H20 G25 C26 C29 H30 P34 K36 I37 A38	Y6 F15 H17 H20 G25 C26 C29 H30 P34 K36 I37 A38
BS02	HEC	A	H20 K23 C49 C52 H53 N56 N57	H20 K23 C49 C52 H53 N56 N57
BS03	HEC	A	N8 K9 K10 V13 D40 K41 A44 H45 C49 K50 K61 C62 C65 H66	N8 K9 K10 V13 D40 K41 A44 H45 C49 K50 K61 C62 C65 H66

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0009061 anaerobic respiration

External links

• PDB: RCSB:1ehj, PDBe:1ehj, PDBj:1ehj
• PDBsum: 1ehj
• PubMed: 10561607
• UniProt: P00137|CYC3_DESAC Cytochrome c3 (Gene Name=cyd)