Structure of PDB 1eh8 Chain A

Receptor sequence
>1eh8A (length=166) Species: 9606 (Homo sapiens) [Search protein sequence]
CEMKRTTLDSPLGKLELSGCEQGLHEIKLLGEVPAPAAVLGGPEPLMQCT
AWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVIS
YQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLA
VKEWLLAHEGHRLGKP
3D structure
PDB1eh8 Active and alkylated human AGT structures: a novel zinc site, inhibitor and extrahelical base binding.
ChainA
Resolution2.5 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) Y114 N137 C145 H146 E172
Catalytic site (residue number reindexed from 1) Y101 N124 C132 H133 E159
Enzyme Commision number 2.1.1.63: methylated-DNA--[protein]-cysteine S-methyltransferase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN A C24 H29 H85 C20 H25 H72
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003824 catalytic activity
GO:0003908 methylated-DNA-[protein]-cysteine S-methyltransferase activity
GO:0008168 methyltransferase activity
GO:0009008 DNA-methyltransferase activity
GO:0046872 metal ion binding
Biological Process
GO:0006259 DNA metabolic process
GO:0006266 DNA ligation
GO:0006281 DNA repair
GO:0006307 DNA alkylation repair
GO:0006974 DNA damage response
GO:0032259 methylation
GO:0043066 negative regulation of apoptotic process
GO:2000781 positive regulation of double-strand break repair
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1eh8, PDBe:1eh8, PDBj:1eh8
PDBsum1eh8
PubMed10747039
UniProtP16455|MGMT_HUMAN Methylated-DNA--protein-cysteine methyltransferase (Gene Name=MGMT)

[Back to BioLiP]