Structure of PDB 1egp Chain A

Receptor sequence
>1egpA (length=39) Species: 6421 (Hirudo medicinalis) [Search protein sequence]
LKSFPEVVGKTVDQAREYFTLHYPQYNVYFLPEGSPVTL
3D structure
PDB1egp Structure of the proteinase inhibitor eglin c with hydrolysed reactive centre at 2.0 A resolution.
ChainA
Resolution2.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A K8 S9 F10 V13 V14 G15 K16 T17 V18 Y32 N33 V34 Y35 F36 L37 P38 E39 G40 K2 S3 F4 V7 V8 G9 K10 T11 V12 Y26 N27 V28 Y29 F30 L31 P32 E33 G34
Gene Ontology
Molecular Function
GO:0004867 serine-type endopeptidase inhibitor activity
Biological Process
GO:0009611 response to wounding

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1egp, PDBe:1egp, PDBj:1egp
PDBsum1egp
PubMed8425603
UniProtP01051|ICIC_HIRME Eglin C

[Back to BioLiP]