Structure of PDB 1egi Chain A |
>1egiA (length=129) Species: 9606 (Homo sapiens) [Search protein sequence] |
CPEDWGASSSLCFKLYAKGKHEKKTWFESRDFCRALGGDLASINNKEEQQ TIWRLITASGSYHKLFWLGLTYGGFTWSDGSPVSYENWAYGEPNNYQNVE YCGELKGDPTMSWNDINCEHLNNWICQIQ |
|
PDB | 1egi Structure of a C-type carbohydrate recognition domain from the macrophage mannose receptor. |
Chain | A |
Resolution | 2.3 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
A |
N747 D748 |
N114 D115 |
|
|
|