Structure of PDB 1ef4 Chain A

Receptor sequence

>1ef4A (length=55) Species: 145262 (Methanothermobacter thermautotrophicus)

MIPVRCLSCGKPVSAYFNEYQRRVADGEDPKDVLDDLGLKRYCCRRMLIS
HVETW

3D structure

• PDB: 1ef4 Zinc-bundle structure of the essential RNA polymerase subunit RPB10 from Methanobacterium thermoautotrophicum.
• Chain: A
• Resolution: N/A

Enzymatic activity

• Enzyme Commision number: 2.7.7.6: DNA-directed RNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	A	C6 C9	C6 C9

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003899 DNA-directed 5'-3' RNA polymerase activity
• GO:0008270 zinc ion binding
• GO:0016779 nucleotidyltransferase activity
• GO:0034062 5'-3' RNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006351 DNA-templated transcription

Cellular Component

• GO:0000428 DNA-directed RNA polymerase complex
• GO:0005737 cytoplasm

External links

• PDB: RCSB:1ef4, PDBe:1ef4, PDBj:1ef4
• PDBsum: 1ef4
• PubMed: 10841539
• UniProt: O26147|RPO10_METTH DNA-directed RNA polymerase subunit Rpo10 (Gene Name=rpo10)