Structure of PDB 1ee8 Chain A

Receptor sequence

>1ee8A (length=266) Species: 300852 (Thermus thermophilus HB8)

PELPEVETTRRRLRPLVLGQTLRQVVHRDPARYRNTALAEGRRILEVDRR
GKFLLFALEGGVELVAHLGMTGGFRLEPTPHTRAALVLEGRTLYFHDPRR
FGRLFGVRRGDYREIPLLLRLGPEPLSEAFAFPGFFRGLKESARPLKALL
LDQRLAAGVGNIYADEALFRARLSPFRPARSLTEEEARRLYRALREVLAE
AVELGGSTLSDQSYRQPDGLPGGFQTRHAVYGREGLPCPACGRPVERRVV
AGRGTHFCPTCQGEGP

3D structure

• PDB: 1ee8 Crystal structure of a repair enzyme of oxidatively damaged DNA, MutM (Fpg), from an extreme thermophile, Thermus thermophilus HB8.
• Chain: A
• Resolution: 1.9 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): P1 E2
• Catalytic site (residue number reindexed from 1): P1 E2
• Enzyme Commision number: 3.2.2.23: DNA-formamidopyrimidine glycosylase.
  4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	A	C238 C241 C258 C261	C238 C241 C258 C261

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003677 DNA binding
• GO:0003684 damaged DNA binding
• GO:0003906 DNA-(apurinic or apyrimidinic site) endonuclease activity
• GO:0008270 zinc ion binding
• GO:0008534 oxidized purine nucleobase lesion DNA N-glycosylase activity
• GO:0016787 hydrolase activity
• GO:0016798 hydrolase activity, acting on glycosyl bonds
• GO:0016799 hydrolase activity, hydrolyzing N-glycosyl compounds
• GO:0016829 lyase activity
• GO:0019104 DNA N-glycosylase activity
• GO:0034039 8-oxo-7,8-dihydroguanine DNA N-glycosylase activity
• GO:0046872 metal ion binding
• GO:0140078 class I DNA-(apurinic or apyrimidinic site) endonuclease activity

Biological Process

• GO:0006281 DNA repair
• GO:0006284 base-excision repair

External links

• PDB: RCSB:1ee8, PDBe:1ee8, PDBj:1ee8
• PDBsum: 1ee8
• PubMed: 10921868
• UniProt: O50606|FPG_THET8 Formamidopyrimidine-DNA glycosylase (Gene Name=mutM)