Structure of PDB 1ecy Chain A

Receptor sequence
>1ecyA (length=142) Species: 562 (Escherichia coli) [Search protein sequence]
AESVQPLEKIAPYPQAEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDC
NLHRLGGKLENKTLEGWGYDYYVFDKVSSPVSTMMACPDGKKEKKFVTAY
LGDAGMLRYNSKLPIVVYTPDNVDVKYRVWKAEEKIDNAVVR
3D structure
PDB1ecy Crystal structure analyses of uncomplexed ecotin in two crystal forms: implications for its function and stability.
ChainA
Resolution2.19 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GLC A H53 P80 V81 S82 H53 P80 V81 S82
BS02 GLC A A1 T28 A1 T28
BS03 GLC A P6 E8 P6 E8
BS04 GLC A E39 L41 E39 L41
Gene Ontology
Molecular Function
GO:0004867 serine-type endopeptidase inhibitor activity
GO:0005515 protein binding
GO:0042803 protein homodimerization activity
Biological Process
GO:0006952 defense response
GO:0010466 negative regulation of peptidase activity
Cellular Component
GO:0030288 outer membrane-bounded periplasmic space
GO:0042597 periplasmic space

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1ecy, PDBe:1ecy, PDBj:1ecy
PDBsum1ecy
PubMed8931142
UniProtP23827|ECOT_ECOLI Ecotin (Gene Name=eco)

[Back to BioLiP]