Structure of PDB 1eco Chain A

Receptor sequence

>1ecoA (length=136) Species: 7155 (Chironomus thummi thummi)

LSADQISTVQASFDKVKGDPVGILYAVFKADPSIMAKFTQFAGKDLESIK
GTAPFETHANRIVGFFSKIIGELPNIEADVNTFVASHKPRGVTHDQLNNF
RAGFVSYMKAHTDFAGAEAAWGATLDTFFGMIFSKM

3D structure

• PDB: 1eco Structure of erythrocruorin in different ligand states refined at 1.4 A resolution.
• Chain: A
• Resolution: 1.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	I34 F38 H58 I62 F66 F83 H87 R90 V92 Q96 L97 F100	I34 F38 H58 I62 F66 F83 H87 R90 V92 Q96 L97 F100

Gene Ontology

Molecular Function

• GO:0005344 oxygen carrier activity
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015671 oxygen transport

Cellular Component

• GO:0005576 extracellular region
• GO:0005833 hemoglobin complex

External links

• PDB: RCSB:1eco, PDBe:1eco, PDBj:1eco
• PDBsum: 1eco
• PubMed: 430568
• UniProt: P02229|GLB3_CHITH Globin CTT-III (Gene Name=A)