Structure of PDB 1eb7 Chain A

Receptor sequence

>1eb7A (length=317) Species: 287 (Pseudomonas aeruginosa)

DALHDQASALFKPIPEQVTELRGQPISEQQRELGKKLFFDPRLSRSHVLS
CNTCHNVGTGGADNVPTSVGHGWQKGPRNSPTVFNAVFNAAQFWDGRAKD
LGEQAKGPIQNSVEMHSTPQLVEQTLGSIPEYVDAFRKAFPKAGKPVSFD
NMALAIEAYEATLVTPDSPFDLYLKGDDKALDAQQKKGLKAFMDSGCSAC
HNGINLGGQAYFPFGLVKKPDADKGRFAVTKTQSDEYVFRAAPLRNVALT
APYFHSGQVWELKDAVAIMGNAQLGKQLAPDDVENIVAFLHSLSGKQPRV
EYPLLPASTETTPRPAE

3D structure

• PDB: 1eb7 Crystal Structure of the Di-Haemcytochrome C Peroxidase from Pseudomonas Aeruginosa
• Chain: A
• Resolution: 2.4 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E114
• Catalytic site (residue number reindexed from 1): E114
• Enzyme Commision number: 1.11.1.5: cytochrome-c peroxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	A	C51 C54 H55 V69 G70 H71 Q74 R78 S80 P81 A86 N89 Q92 F93 W94 P108 R246	C51 C54 H55 V69 G70 H71 Q74 R78 S80 P81 A86 N89 Q92 F93 W94 P108 R240
BS02	HEC	A	W94 C197 C200 H201 F214 G215 L216 R246 L250 Y259 F260 H261 M275 L280	W94 C197 C200 H201 F214 G215 L216 R240 L244 Y253 F254 H255 M269 L274
BS03	CA	A	N79 T256 P258	N79 T250 P252

Gene Ontology

Molecular Function

• GO:0004130 cytochrome-c peroxidase activity
• GO:0004601 peroxidase activity
• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0042597 periplasmic space

External links

• PDB: RCSB:1eb7, PDBe:1eb7, PDBj:1eb7
• PDBsum: 1eb7
• PubMed: 8591033
• UniProt: P14532|CCPR_PSEAE Cytochrome c551 peroxidase (Gene Name=ccpA)