Structure of PDB 1eaq Chain A |
>1eaqA (length=124) Species: 10090 (Mus musculus) [Search protein sequence] |
SMVEVLADHPGELVRTDSPNFLSSVLPTHWRSNKTLPIAFKVVALGDVPD GTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLT ITVFTNPPQVATYHRAIKITVDGP |
|
PDB | 1eaq The Runx1 Runt Domain at 1.25 A Resolution: A Structural Switch and Specifically Bound Chloride Ions Modulate DNA Binding |
Chain | A |
Resolution | 1.25 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CL |
A |
R139 T169 |
R90 T120 |
|
|
|
|