Structure of PDB 1e29 Chain A

Receptor sequence
>1e29A (length=135) Species: 1143 (Synechocystis sp.) [Search protein sequence]
VELTESTRTIPLDEAGGTTTLTARQFTNGQKIFVDTCTQCHLQGKTKTNN
NVSLGLADLAGAEPRRDNVLALVEFLKNPKSYDGEDDYSELHPNISRPDI
YPEMRNYTEDDIFDVAGYTLIAPKLDERWGGTIYF
3D structure
PDB1e29 Crystal Structure of Low-Potential Cytochrome C549 from Synechocystis Sp. Pcc 6803 at 1.21A Resolution
ChainA
Resolution1.21 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEC A C37 Q39 C40 H41 N49 V52 S53 L54 D58 L59 R66 F75 Y82 H92 P93 C37 Q39 C40 H41 N49 V52 S53 L54 D58 L59 R66 F75 Y82 H92 P93
BS02 CA A N49 N50 N49 N50
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0015979 photosynthesis
GO:0018063 cytochrome c-heme linkage
GO:0019684 photosynthesis, light reaction
GO:0022904 respiratory electron transport chain
Cellular Component
GO:0009523 photosystem II
GO:0009579 thylakoid
GO:0016020 membrane
GO:0030096 plasma membrane-derived thylakoid photosystem II
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1e29, PDBe:1e29, PDBj:1e29
PDBsum1e29
PubMed11315568
UniProtQ55013|CY550_SYNY3 Photosystem II extrinsic protein V (Gene Name=psbV)

[Back to BioLiP]