Structure of PDB 1dxm Chain A |
>1dxmA (length=131) Species: 3888 (Pisum sativum) [Search protein sequence] |
SNVLDGLKYAPSHEWVKHEGSVATIGITDHAQDHLGEVVFVELPEPGVSV TKGKGFGAVESVKATSDVNSPISGEVIEVNTGLTGKPGLINSSPYEDGWM IKIKPTSPDELESLLGAKEYTKFCEEEDAAH |
|
PDB | 1dxm Interaction between the Lipoamide-Containing H-Protein and the Lipoamide Dehydrogenase (L-Protein) of the Glycine Decarboxylase Multienzyme System. 2. Crystal Structure of H- and L-Proteins |
Chain | A |
Resolution | 2.6 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
RED |
A |
H34 L35 K63 E127 |
H34 L35 K63 E127 |
|
|
|
|