Structure of PDB 1dvz Chain A

Receptor sequence

>1dvzA (length=115) Species: 9606 (Homo sapiens)

CPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLT
TEEQFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAA
LLSPYSYSTTAVVTN

3D structure

• PDB: 1dvz Rational design of potent human transthyretin amyloid disease inhibitors.
• Chain: A
• Resolution: 1.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	OFL	A	K15 L17 A108	K6 L8 A99	MOAD: Kd=78nM

Gene Ontology

Molecular Function

• GO:0005179 hormone activity
• GO:0005515 protein binding
• GO:0042802 identical protein binding
• GO:0070324 thyroid hormone binding

Biological Process

• GO:0006144 purine nucleobase metabolic process
• GO:0007165 signal transduction

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space
• GO:0005737 cytoplasm
• GO:0035578 azurophil granule lumen
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:1dvz, PDBe:1dvz, PDBj:1dvz
• PDBsum: 1dvz
• PubMed: 10742177
• UniProt: P02766|TTHY_HUMAN Transthyretin (Gene Name=TTR)