Structure of PDB 1dtl Chain A

Receptor sequence

>1dtlA (length=149) Species: 9031 (Gallus gallus)

YKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQNPTP
EELQEMIDEVDEDGSGTVDFDEFLVMMVRSMKKSEEELSDLFRMFDKNAD
GYIDLEELKIMLQATTITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGV

3D structure

• PDB: 1dtl Bepridil opens the regulatory N-terminal lobe of cardiac troponin C.
• Chain: A
• Resolution: 2.15 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	A	D65 D67 S69 T71 E76	D61 D63 S65 T67 E72
BS02	CA	A	D105 N107 D109 Y111 E116	D96 N98 D100 Y102 E107
BS03	CA	A	D141 N143 D145 R147 E152	D130 N132 D134 R136 E141
BS04	BEP	A	F27 L41 M45 M60 M80 E96	F23 L37 M41 M56 M76 E87
BS05	BEP	A	F20 A23 F27 M81 F104 L117 M120 F153 F156 M157	F16 A19 F23 M77 F95 L108 M111 F142 F145 M146
BS06	BEP	A	M45 Q50 P52 E56 E96 D99 M103	M41 Q46 P48 E52 E87 D90 M94

Gene Ontology

Molecular Function

• GO:0005509 calcium ion binding
• GO:0031013 troponin I binding
• GO:0046872 metal ion binding
• GO:0048306 calcium-dependent protein binding

Biological Process

• GO:0003009 skeletal muscle contraction
• GO:0060048 cardiac muscle contraction

Cellular Component

• GO:1990584 cardiac Troponin complex

External links

• PDB: RCSB:1dtl, PDBe:1dtl, PDBj:1dtl
• PDBsum: 1dtl
• PubMed: 10792039
• UniProt: P09860|TNNC1_CHICK Troponin C, slow skeletal and cardiac muscles (Gene Name=TNNC1)