Structure of PDB 1ds6 Chain A

Receptor sequence

>1ds6A (length=181) Species: 9606 (Homo sapiens) [Search protein sequence]

MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKP
VNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPE
VRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEID
SVKYLECSALTQRGLKTVFDEAIRAVLCPQP

3D structure

PDB

1ds6 The Rac-RhoGDI complex and the structural basis for the regulation of Rho proteins by RhoGDI.

Chain

Resolution

2.35 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	A	T17 T35	T17 T35
BS02	GDP	A	G12 A13 V14 G15 K16 T17 C18 I33 K116 D118 L119 S158 L160	G12 A13 V14 G15 K16 T17 C18 I33 K116 D118 L119 S158 L160

Gene Ontology

	Molecular Function
GO:0003924	GTPase activity
GO:0005515	protein binding
GO:0005525	GTP binding
GO:0019887	protein kinase regulator activity

	Biological Process
GO:0006935	chemotaxis
GO:0007015	actin filament organization
GO:0007165	signal transduction
GO:0007186	G protein-coupled receptor signaling pathway
GO:0007264	small GTPase-mediated signal transduction
GO:0008283	cell population proliferation
GO:0010310	regulation of hydrogen peroxide metabolic process
GO:0010592	positive regulation of lamellipodium assembly
GO:0010810	regulation of cell-substrate adhesion
GO:0030031	cell projection assembly
GO:0030036	actin cytoskeleton organization
GO:0042129	regulation of T cell proliferation
GO:0043131	erythrocyte enucleation
GO:0043304	regulation of mast cell degranulation
GO:0045453	bone resorption
GO:0045730	respiratory burst
GO:0060263	regulation of respiratory burst
GO:0060753	regulation of mast cell chemotaxis
GO:0070662	mast cell proliferation
GO:0070668	positive regulation of mast cell proliferation
GO:0071593	lymphocyte aggregation
GO:0090023	positive regulation of neutrophil chemotaxis
GO:1902622	regulation of neutrophil migration
GO:1903955	positive regulation of protein targeting to mitochondrion

	Cellular Component
GO:0005635	nuclear envelope
GO:0005737	cytoplasm
GO:0005741	mitochondrial outer membrane
GO:0005789	endoplasmic reticulum membrane
GO:0005829	cytosol
GO:0005884	actin filament
GO:0005886	plasma membrane
GO:0005925	focal adhesion
GO:0016020	membrane
GO:0030027	lamellipodium
GO:0030670	phagocytic vesicle membrane
GO:0043020	NADPH oxidase complex
GO:0070062	extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1ds6, PDBe:1ds6, PDBj:1ds6
PDBsum	1ds6
PubMed	10655614
UniProt	P15153\|RAC2_HUMAN Ras-related C3 botulinum toxin substrate 2 (Gene Name=RAC2)

[Back to BioLiP]