Structure of PDB 1drg Chain A

Receptor sequence

>1drgA (length=313) Species: 10678 (Punavirus P1) [Search protein sequence]

DEVRKNLMDMFRDRQAFSEHTWKMLLSVCRSWAAWCKLNNRKWFPAEPED
VRDYLLYLQARGLAVKTIQQHLGQLNMLHRRSGLPRPSDSNAVSLVMRRI
RKENVDAGERAKQALAFERTDFDQVRSLMENSDRCQDIRNLAFLGIAYNT
LLRIAEIARIRVKDISRTDGGRMLIHIGVEKALSLGVTKLVERWISVSGV
ADDPNNYLFCRVRKNGVAAPSATSQLSTRALEGIFEATHRLIYGAKDDSG
QRYLAWSGHSARVGAARDMARAGVSIPEIMQAGGWTNVNIVMNFIRNLDS
ETGAMVRLLEDGD

3D structure

PDB

1drg Quasi-equivalence in site-specific recombinase structure and function: crystal structure and activity of trimeric Cre recombinase bound to a three-way Lox DNA junction

Chain

Resolution

2.55 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	M44 S47 R50 R81 L83 A84 K86 T87 Q90 A131 K132 Q133 Q156 R159 R241 V242 R243 K244 L256 S257 R259 A260 R282 R292 W315 I320 F324 R326	M24 S27 R30 R61 L63 A64 K66 T67 Q70 A111 K112 Q113 Q136 R139 R211 V212 R213 K214 L226 S227 R229 A230 R252 R262 W285 I290 F294 R296
BS02	dna	A	F37 S38 H40 T41 Q90 R100 R106 R121 R173 I174 A175 R243 K244 N245 R259 E262 R282 Y283 S287 G288 H289	F17 S18 H20 T21 Q70 R80 R86 R101 R153 I154 A155 R213 K214 N215 R229 E232 R252 Y253 S257 G258 H259

Gene Ontology

	Molecular Function
GO:0003677	DNA binding

	Biological Process
GO:0006310	DNA recombination
GO:0015074	DNA integration

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1drg, PDBe:1drg, PDBj:1drg
PDBsum	1drg
PubMed	11601846
UniProt	P06956\|RECR_BPP1 Recombinase cre (Gene Name=cre)

[Back to BioLiP]