Structure of PDB 1dor Chain A

Receptor sequence

>1dorA (length=311) Species: 1358 (Lactococcus lactis)

MLNTTFANAKFANPFMNASGVHCMTIEDLEELKASQAGAYITKSSTLEKR
EGNPLPRYVDLELGSINSMGLPNLGFDYYLDYVLKNQKENAQEGPIFFSI
AGMSAAENIAMLKKIQESDFSGITELNLSCPNVPGKPQLAYDFEATEKLL
KEVFTFFTKPLGVKLPPYFDLVHFDIMAEILNQFPLTYVNSVNSIGNGLF
IDPEAESVVIKPKDGFGGIGGAYIKPTALANVRAFYTRLKPEIQIIGTGG
IETGQDAFEHLLCGATMLQIGTALHKEGPAIFDRIIKELEEIMNQKGYQS
IADFHGKLKSL

3D structure

• PDB: 1dor The crystal structure of the flavin containing enzyme dihydroorotate dehydrogenase A from Lactococcus lactis.
• Chain: A
• Resolution: 2.0 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): K43 N67 L71 C130 N132 V133 K164 V192
• Catalytic site (residue number reindexed from 1): K43 N67 L71 C130 N132 V133 K164 V192
• Enzyme Commision number: 1.3.98.1: dihydroorotate oxidase (fumarate).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FMN	A	S19 G20 K43 S44 N127 K164 V192 N193 G221 T248 G249 G271 T272	S19 G20 K43 S44 N127 K164 V192 N193 G221 T248 G249 G271 T272

Gene Ontology

Molecular Function

• GO:0004152 dihydroorotate dehydrogenase activity
• GO:0016491 oxidoreductase activity
• GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors
• GO:1990663 dihydroorotate dehydrogenase (fumarate) activity

Biological Process

• GO:0006207 'de novo' pyrimidine nucleobase biosynthetic process
• GO:0006221 pyrimidine nucleotide biosynthetic process
• GO:0006222 UMP biosynthetic process
• GO:0044205 'de novo' UMP biosynthetic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:1dor, PDBe:1dor, PDBj:1dor
• PDBsum: 1dor
• PubMed: 9032071
• UniProt: A2RJT9|PYRDA_LACLM Dihydroorotate dehydrogenase A (fumarate) (Gene Name=pyrDA)