Structure of PDB 1dk1 Chain A

Receptor sequence
>1dk1A (length=86) Species: 274 (Thermus thermophilus) [Search protein sequence]
PITKEEKQKVMQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHH
SHRGLLMMVGQRRRLLRYLQREDPERYRMLIEKLGI
3D structure
PDB1dk1 Crystal structure of the S15-rRNA complex.
ChainA
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna A P101 K107 M111 T121 G122 S123 Q127 L130 R134 L138 H141 H145 K147 D148 H150 S151 M158 R164 Y168 P1 K7 M11 T21 G22 S23 Q27 L30 R34 L38 H41 H45 K47 D48 H50 S51 M58 R64 Y68
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1dk1, PDBe:1dk1, PDBj:1dk1
PDBsum1dk1
PubMed10742169
UniProtP80378|RS15_THETH Small ribosomal subunit protein uS15 (Gene Name=rpsO)

[Back to BioLiP]