Structure of PDB 1dg5 Chain A

Receptor sequence

>1dg5A (length=159) Species: 1773 (Mycobacterium tuberculosis)

MVGLIWAQATSGVIGRGGDIPWRLPEDQAHFREITMGHTIVMGRRTWDSL
PAKVRPLPGRRNVVLSRQADFMASGAEVVGSLEEALTSPETWVIGGGQVY
ALALPYATRCEVTEVDIGLPREAGDALAPVLDETWRGETGEWRFSRSGLR
YRLYSYHRS

3D structure

• PDB: 1dg5 Three-dimensional structure of M. tuberculosis dihydrofolate reductase reveals opportunities for the design of novel tuberculosis drugs.
• Chain: A
• Resolution: 2.0 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): I5 I20 W22 D27 Q28 F31 L57 T91 T113
• Catalytic site (residue number reindexed from 1): I5 I20 W22 D27 Q28 F31 L57 T91 T113
• Enzyme Commision number: 1.5.1.3: dihydrofolate reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NDP	A	W6 A7 I14 G18 D19 G43 R44 R45 T46 L65 S66 R67 G80 I94 G96 G97 Q98 V99 L102 A126	W6 A7 I14 G18 D19 G43 R44 R45 T46 L65 S66 R67 G80 I94 G96 G97 Q98 V99 L102 A126
BS02	TOP	A	I5 W6 D27 F31 L50 I94	I5 W6 D27 F31 L50 I94	MOAD: Ki=88uM BindingDB: IC50=88000nM
BS03	GOL	A	A101 A128 P129	A101 A128 P129

Gene Ontology

Molecular Function

• GO:0004146 dihydrofolate reductase activity
• GO:0016491 oxidoreductase activity
• GO:0050661 NADP binding
• GO:0070401 NADP+ binding

Biological Process

• GO:0006730 one-carbon metabolic process
• GO:0046452 dihydrofolate metabolic process
• GO:0046654 tetrahydrofolate biosynthetic process
• GO:0046655 folic acid metabolic process

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:1dg5, PDBe:1dg5, PDBj:1dg5
• PDBsum: 1dg5
• PubMed: 10623528
• UniProt: P9WNX1|DYR_MYCTU Dihydrofolate reductase (Gene Name=folA)