Structure of PDB 1def Chain A |
>1defA (length=147) Species: 562 (Escherichia coli) [Search protein sequence] |
SVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQ VDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALV PRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLS |
|
PDB | 1def A new subclass of the zinc metalloproteases superfamily revealed by the solution structure of peptide deformylase. |
Chain | A |
Resolution | N/A |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
E88 C90 H132 H136 |
E88 C90 H132 H136 |
|
|
|
|