Structure of PDB 1dea Chain A

Receptor sequence

>1deaA (length=266) Species: 562 (Escherichia coli)

MRLIPLTTAEQVGKWAARHIVNRINAFKPTADRPFVLGLPTGGTPMTTYK
ALVEMHKAGQVSFKHVVTFNMDEYVGLPKEHPESYYSFMHRNFFDHVDIP
AENINLLNGNAPDIDAECRQYEEKIRSYGKIHLFMGGVGNDGHIAFNEPA
SSLASRTRIKTLTHDTRVANSRFFDNDVNQVPKYALTVGVGTLLDAEEVM
ILVLGSQKALALQAAVEGCVNHMWTISCLQLHPKAIMVCDEPSTMELKVK
TLRYFNELEAENIKGL

3D structure

• PDB: 1dea Structure and catalytic mechanism of glucosamine 6-phosphate deaminase from Escherichia coli at 2.1 A resolution.
• Chain: A
• Resolution: 2.1 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D72 D141 H143 E148
• Catalytic site (residue number reindexed from 1): D72 D141 H143 E148
• Enzyme Commision number: 3.5.99.6: glucosamine-6-phosphate deaminase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PO4	A	G42 G43 T44 R172	G42 G43 T44 R172

Gene Ontology

Molecular Function

• GO:0004342 glucosamine-6-phosphate deaminase activity
• GO:0005515 protein binding
• GO:0016787 hydrolase activity
• GO:0042802 identical protein binding

Biological Process

• GO:0005975 carbohydrate metabolic process
• GO:0006043 glucosamine catabolic process
• GO:0006044 N-acetylglucosamine metabolic process
• GO:0006046 N-acetylglucosamine catabolic process
• GO:0006048 UDP-N-acetylglucosamine biosynthetic process
• GO:0019262 N-acetylneuraminate catabolic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:1dea, PDBe:1dea, PDBj:1dea
• PDBsum: 1dea
• PubMed: 8747459
• UniProt: P0A759|NAGB_ECOLI Glucosamine-6-phosphate deaminase (Gene Name=nagB)