Structure of PDB 1dck Chain A |
>1dckA (length=123) Species: 382 (Sinorhizobium meliloti) [Search protein sequence] |
MQDYTVHIVDDEEPVRKSLAFMLTMNGFAVKMHQSAEAFLAFAPDVRNGV LVTDLRMPDMSGVELLRNLGDLKINIPSIVITGHGDVPMAVEAMKAGAVD FIEKPFEDTVIIEAIERASEHLV |
|
PDB | 1dck Structural transitions in the FixJ receiver domain. |
Chain | A |
Resolution | 2.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MN |
A |
D11 D54 R56 |
D11 D54 R56 |
|
|
|
|