Structure of PDB 1dc1 Chain A

Receptor sequence

>1dc1A (length=310) Species: 1422 (Geobacillus stearothermophilus)

KPFENHLKSVDDLKTTYEEYRAGFIAFALEKNKRSTPYIERARALKVAAS
VAKTPKDLLYLEDIQDALLYASGISDKAKKFLTEDDKKESINNLIENFLE
PAGEEFIDELIFRYLLFQGDSLGGTMRNIAGALAQQKLTRAIISALDIAN
IPYKWLDSRDKKYTNWMDKPEDDYELETFAKGISWTINGKHRTLMYNITV
SLVKKNVDICLFNCEPQQPEKYLLLGELKGGIDPAGADEHWKTANTALTR
IRNKFSEKGLSPKTIFIGAAIEHSMAEEIWDQLQSGSLTNSANLTKTEQV
GSLCRWIINI

3D structure

• PDB: 1dc1 Restriction enzyme BsoBI-DNA complex: a tunnel for recognition of degenerate DNA sequences and potential histidine catalysis.
• Chain: A
• Resolution: 1.7 Å

Enzymatic activity

• Enzyme Commision number: 3.1.21.4: type II site-specific deoxyribonuclease.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	Y74 S79 D80 K81 D124 G128 R131 N132 Y167 K185 A248 E252 K255 S287	Y70 S75 D76 K77 D120 G124 R127 N128 Y163 K181 A235 E239 K242 S274
BS02	dna	A	F31 R131 N132 G135 K209 N210 D212 K242 G243 G244 I245 D246 H253	F27 R127 N128 G131 K205 N206 D208 K229 G230 G231 I232 D233 H240

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0004519 endonuclease activity
• GO:0009036 type II site-specific deoxyribonuclease activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009307 DNA restriction-modification system

External links

• PDB: RCSB:1dc1, PDBe:1dc1, PDBj:1dc1
• PDBsum: 1dc1
• PubMed: 11250198
• UniProt: P70985|T2B1_GEOSE Type II restriction enzyme BsoBI (Gene Name=bsoBIR)